VIP
The active vasoactive intestinal peptide, studied in immune-modulation and mould-exposure illness research.
Vasoactive Intestinal Peptide (VIP) is an endogenous physiological neuropeptide hormone of 28 amino acids in a precise sequence ending in an amide group — HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 — belonging functionally and structurally to the Secretin/Glucagon superfamily. VIP acts as a high-affinity selective agonist of Gs-coupled neuropeptide membrane receptors, specifically VPAC1 and VPAC2, which are densely distributed in the respiratory tract, pulmonary and systemic blood vessels, immune cells and the central and peripheral digestive system. This binding activates adenylate cyclase, increasing cyclic AMP (cAMP) and activating protein kinase A (PKA), while also stimulating the nitric-oxide synthase (eNOS/iNOS) pathway — causing immediate, deep relaxation of airway smooth muscle, dilation of the pulmonary arteries and reduced pulmonary vascular resistance. Besides dilating vessels and airways, VIP is a potent systemic anti-inflammatory and immunomodulator: it inhibits activation of nuclear factor kappa B (NF-κB) and restrains excessive inflammatory cytokines such as TNF-α, IL-1β and IL-6, while stimulating the differentiation and proliferation of regulatory T cells (Tregs), inhibiting the fibroblast activation that causes lung and connective-tissue fibrosis, and correcting the disturbances of chronic inflammatory response syndrome (CIRS) and exposure to fungal toxins and indoor mould (mycotoxins / mould illness).
The leading neural dilator of the airways and pulmonary vessels, a natural immune modulator and a treatment for chronic inflammatory syndrome and mould toxicity
If you want to restore deep, free breathing and open constricted airways, ease high vascular pressure on the lungs and heart, and reset the immune system to quiet chronic systemic inflammation caused by environmental toxins, indoor mould and chronic inflammatory response syndrome (CIRS) — without relying on draining corticosteroids — VIP (Vasoactive Intestinal Peptide / Aviptadil) is the most distinguished and documented innate molecule in advanced immunology, respiratory and environmental medicine.
Classification: Digestive and pulmonary neuropeptides, VPAC1 and VPAC2 agonists, airway and pulmonary vasodilators, and systemic anti-inflammatory and CIRS therapeutics (Neuro-Endocrine Peptides / VPAC Agonists / Pulmonary Vasodilators / CIRS & Anti-Inflammatory Therapeutics).
Structurally, it is a pure linear 28-amino-acid peptide with a protective amidated end that preserves its structural integrity. This natural structure gives it an outstanding ability to mimic innate neural signals and communicate directly with vessel, airway and immune-cell receptors without toxic or allergic reactions.
Picture your lungs and blood vessels during inflammation and stress as a stifling room with its windows shut tight and its temperature rising from an internal smoke storm (inflammatory cytokines and toxins). Conventional drugs merely hand you a temporary breathing mask, whereas VIP is a current of fresh air that opens the closed windows in moments (dilating airways and vessels) while completely putting out the source of the smoke, so the environment becomes clean and liveable again.
How it works
VIP binds VPAC1 and VPAC2 receptors on smooth-muscle cells in the lungs and arteries, triggering intracellular cascades that raise cAMP and nitric oxide. This immediately relaxes the muscle spasms around the bronchi and smoothly dilates the pulmonary arteries, lowering pulmonary artery pressure so oxygen flows freely to all of the body's tissues. On the immune and metabolic side, the peptide penetrates lymphocyte pathways to inhibit the inflammatory factor NF-κB, stopping production of destructive cytokines and stimulating the regulatory T cells responsible for immune calm — making it a cornerstone of CIRS protocols for clearing the body of inflammation caused by mould toxins (mould illness) and chronic Lyme. It also plays a key protective role in preventing lung-tissue fibrosis, regulating fluid and salt movement in the intestinal lining and protecting brain neurons from damage caused by chronic inflammation.
In clinical and medical settings worldwide, VIP (also known medically as Aviptadil) has undergone advanced trials for acute respiratory distress syndrome (ARDS) and pulmonary arterial hypertension (PAH), and leaders in functional and environmental medicine rely on it as the strongest peptide protocol for restoring hypothalamic pathways, treating CIRS and rehabilitating lung and immune efficiency with excellent biocompatibility.
Restoring natural breathing capacity and breaking the cycle of chronic systemic inflammation no longer requires chemical compounds that suppress the body — it rests on harnessing the innate signalling language that opens the airways and preserves immune balance at its original cellular source.
The most powerful innate pulmonary dilator and immune modulator for chronic inflammation, open airways and clearing mould toxins. VIP is an advanced neuropeptide achievement designed to restore clean breathing and calm the immune system in the face of the toughest environmental challenges. It belongs to the class of immune- and vessel-regulating peptides that stimulate VPAC1 and VPAC2 receptors, lower pulmonary artery pressure and support recovery from chronic inflammatory response syndrome (CIRS). Its ultra-pure natural peptide structure binds directly to the walls of the bronchi and arteries, acting as a precise physiological stimulant that raises nitric oxide and cAMP to relax respiratory spasms and flood the lungs with oxygen. Its unique mechanism restrains excessive inflammatory cytokines, activates regulatory T cells and resists lung-tissue fibrosis — relieving the chronic fatigue and brain fog linked to fungal toxins and persistent inflammation without straining the body's vital systems. Leading chest and functional-medicine physicians study it as one of the strongest biological compounds for rebuilding respiratory and immune resilience — because real health and vitality begin by freeing the pathways of breath and regulating the language of cellular defence with a pure code that restores your body's comfort and innate balance.
